PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_18778_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family ZF-HD
Protein Properties Length: 277aa    MW: 29455.6 Da    PI: 8.3973
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_18778_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.82e-3190143458
                           ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                                           +rY+eClkNhAas+Gg+++DGCgEfmps geegt +a+kCaAC+CHRnFHR+e++
  cra_locus_18778_iso_1_len_1586_ver_3  90 IRYRECLKNHAASTGGNVTDGCGEFMPS-GEEGTLEAFKCAACNCHRNFHRKESN 143
                                           79*************************9.999********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-2285143IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.0E-2990142IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.9E-2991141IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.41792141IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.45E-12214277IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-23225277IPR009057Homeodomain-like
TIGRFAMsTIGR015657.3E-23226277IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MALTGEDKEM RMPAGSLGYE SLENLDQHTQ GHHHQQQQQQ HEHLLNIQQE KSRGGGGGGG  60
NGFNSGGGGG GGGGSKSRTP TGRNSATNII RYRECLKNHA ASTGGNVTDG CGEFMPSGEE  120
GTLEAFKCAA CNCHRNFHRK ESNGGGGGGG GGGEGAIMLH PLHLPSAAAI PSPSWTTTMV  180
QPVKMAFRGG GGGSASAGTD SSSEELNFNT YHSTSIPPPP QFVLAKKRFR TKFSQEQKDK  240
MLAFAEKLGW RIPREDDTEV QRFCAEVGVK RQVFKVW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A7e-212272771868ZF-HD homeobox family protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16474SGGGGGGGGGS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083674.12e-92PREDICTED: zinc-finger homeodomain protein 5
SwissprotQ9ZPW75e-54ZHD6_ARATH; Zinc-finger homeodomain protein 6
SwissprotQ9M9S07e-54ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A068UH151e-117A0A068UH15_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000095812e-83(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128